Skip to main content
Skip to content
Case File
efta-02175385DOJ Data Set 10Other

EFTA02175385

Date
Unknown
Source
DOJ Data Set 10
Reference
efta-02175385
Pages
2
Persons
0
Integrity

Summary

Ask AI About This Document

0Share
PostReddit

Extracted Text (OCR)

EFTA Disclosure
Text extracted via OCR from the original document. May contain errors from the scanning process.
To: Cecile de Jongh From: Lesley Groff Sent: Thur 2/9/2012 6:15:47 PM Subject: Re: Accessing jeffreyepstein. Org great. On Feb 9, 2012, at I:13 PM, Cecile de Jongh wrote: OK, will do when he comes in. With warm regards, Cecile DISCLAIMER: The information contained in this e-mail may be privileged,confidential, and protected from disclosure. If you are not the intended recipient, you are hereby notified that any dissemination, distribution or duplication of this communication is strictly prohibited. If you have received this communication in error, please notify the sender immediately and delete all copies. "Nearly all men can stand adversity, but if you want to test a man's character, give him power? — Abraham Lincoln 4A Please consider the environment before printing this e-mail. From: Lesley Groff To: Cecile de Jongh Sent: Thursday, February 9, 2012 1:10 PM Subject: Fwd: Accessing jeffreyepstein. Org Cecile, Darren did not set these up...he says he thinks Al Seckle did...but for you to still speak to JE about it as Darren is only guessing. In Case you need Al Seekle's info, this is what is in our directory: Al seek ,c Begin forwarded message: From: --< all g waitra> Date: February 9, 2012 12:25:10 PM EST To: Cecile de Jongh Jeffrey EFTA_R1_00861855 EFTA02175385 Epstein ea Subject: Accessing jeffreyepstein. Org Hi Cecile and Lesley, For us to get access to wwwjeffreyepstein.org and wwwieffreyepsteinscience.com, we will need to find one of the items below: Either: I--the last four digits of a visa credit card used to set up the domain in 2010. Purchased from Host Gator. Or: 2--the email addresses used for the purchase. One ended in gte,net the other ended in mai coime‘‘ media cm Lesley, do you think you could do a search in your email to see if anyone working for Jeffrey used one of these email endings? Cecile is going to ask Jeffrey the same thing. Thatilcou so much! EFTA_R1_00861856 EFTA02175386

Technical Artifacts (4)

View in Artifacts Browser

Email addresses, URLs, phone numbers, and other technical indicators extracted from this document.

Domainwwwieffreyepsteinscience.com
Domainwwwjeffreyepstein.org
Phone2175385
Phone2175386

Forum Discussions

This document was digitized, indexed, and cross-referenced with 1,400+ persons in the Epstein files. 100% free, ad-free, and independent.

Annotations powered by Hypothesis. Select any text on this page to annotate or highlight it.